PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 186aa    MW: 21871.7 Da    PI: 6.6999
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00793genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.61e-1696152561
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 +++rr+++NRe+ArrsR RK+  ++eL   vk L +eN++L+++ ++l+++ +++  
  AA53G00793  96 RKQRRMISNRESARRSRMRKQRHLDELWSQVKRLRNENHSLIDKFNNLSETHDSVLL 152
                 79***********************************************99887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-1592156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-1293146No hitNo description
PROSITE profilePS5021711.00194145IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-1396146No hitNo description
PfamPF001702.2E-1496151IPR004827Basic-leucine zipper domain
CDDcd147021.78E-1997148No hitNo description
PROSITE patternPS00036099114IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MNPAEISGYF QYLSPENSSN IPSEFNMINL PSSPTSSSSF YYLNDLINYS SSSNGQDLII  60
MSNNSTSGDE DHHHHHHQHQ HHEHHHDDHE IVNDERKQRR MISNRESARR SRMRKQRHLD  120
ELWSQVKRLR NENHSLIDKF NNLSETHDSV LLHNSKLQQQ VSQLRHLVSQ LQSNNNNGFV  180
TELEDF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108115RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613647.11e-74PREDICTED: basic leucine zipper 43
TrEMBLA0A0D3AVT91e-74A0A0D3AVT9_BRAOL; Uncharacterized protein
STRINGBra017359.1-P3e-66(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.17e-49basic leucine-zipper 58